SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060962 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060962
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily UBC-like 2.07e-61
Family UBC-related 0.000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060962   Gene: ENSRNOG00000013741   Transcript: ENSRNOT00000066204
Sequence length 150
Comment pep:known chromosome:RGSC3.4:2:232957962:232971639:1 gene:ENSRNOG00000013741 transcript:ENSRNOT00000066204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDY
PFKPPKASIVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD
PLVPEIARIYKTDRDKYNRISREWTQKYAM
Download sequence
Identical sequences 10116.ENSRNOP00000045087 ENSRNOP00000060962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]