SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061147 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061147
Domain Number 1 Region: 1335-1447
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-33
Family PDZ domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 1747-1924
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-28
Family Nucleotide and nucleoside kinases 0.00012
Further Details:      
 
Domain Number 3 Region: 598-710
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-16
Family PDZ domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1502-1594
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-16
Family PDZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 722-794
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-16
Family PDZ domain 0.025
Further Details:      
 
Domain Number 6 Region: 1603-1667
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000958
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 7 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000441
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061147   Gene: ENSRNOG00000005783   Transcript: ENSRNOT00000067057
Sequence length 1927
Comment pep:known chromosome:RGSC3.4:15:118948:207783:1 gene:ENSRNOG00000005783 transcript:ENSRNOT00000067057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLQLL
LAKEQDHFQDLRAALEKTQPHLLPILYLNGVVGPPQSTEGAGSTYSVLSIMPSDSESSSS
LSSVGTTGKAPSPPPLLTEQQANDKVENLSIQLRLMTRERNELRKRLAFATHGATFDKRP
YHRLNPDYERLKIQCVRAMSDLQSLQNQHTNALKRCEEVAKETDFYHTLHSRLLSDQTQL
KDDVDMLRRENGKLRRERNLLQQSWEDMKRLREEDQKEIGDLRAQQQQVLKHNGSSEILN
KLYDTAMDKLEVVKKDYDALRKRYSEKVAMHNSDLSRLEQLGEENQRLQKQTEMLTQQRD
TAIQLQHQCALSLRRFETIHHELSKATAQNKDLQWEMELLQSELTELRSKQVKTAKESEK
YKEERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAASEEVEALRQI
KDTVTMDAGRANKEVEVLRKQCKALCQELKEALQEADVAKCRRDWAFRERDKIVAERDSI
RTLCDNLRRERDRAVSELAEALRSLDDTRKQKNDVSRELKELKEQMECQLEKEARFRQLM
AHSSHDSAIDTDSMEWETEVVEFVRETEDIDLKALGFDMAEGVNEPCFPGDCGIFVTKVD
KGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEGAINMVVRRRKSLGGKVVTPL
HINLSGQKDSGISLENGVYAAAVVPGSPAAKEGSLAVGDRIVAINGIALDNKSLNECESL
LRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDRMLSCRAHGPEVQAHNKRNLLQHNN
STQTDIFYTDRLEDRKELDHSGGSSSYLYKPFSGASSPASPQACPSTSERSLNSFRSDTS
AERGYGLVDVQSQRPLLSFETEVGPCGTVGAPLDKIDPEGSNSGGTWPKAVLGSTSGPEK
LSVYKKPKQRKSIFDPNTFKRPQTPPKVDYLLPGLGLTHSPQPSKRADTPKGSLTPPKPP
RRSDSIKFQHRLETSSESEATLVGSSPSTSPPSAPPPSMDPSEPMHASPPRKARVRIASS
YHSEGDGDTSYLPVKKPCDEDLTSQKVDELGQKRRRPKSAPSFRPKISPVVIPAQCLEEQ
DCAPVSGELSPEAQDWSPYTLGHASRPGNPLLYPNRPSVGTVPRSMTPSTTVSSILRNPI
YTVRSHRVVPCGSPPVPRDAGSHSLSSSVQHQGRLSLDLSHRACSDYSEMRASQGSNSLP
SSARLGSSSNLQFKAERIKIPLTPRYPRSVMGSDRGSLSHSECSTPPRSPLNVDALSFCS
QPQTSASTLPRIAVNSSSHGERRKDRPFVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSK
VTMGSIAHQAGLEYGDQLLEFNGINLRSATEQQARLIIGQQCDTITILAQYNPHIHQLNS
HSRSSSHLDPAAAPHSTLQGSSAATPEHPSVIDPLMEQDEGPGTPPAKQSTPSSRIVGDA
SKKTPEPRIVFIKKSQLDLGVQLCGGNLHGVFVAEVEDDSPAKGPDGLVPGDLILEYGNL
DMRSRTLEDVYVEMMKPKDSIRLKVQYRHEEFTRVKGLSGDSFYIRALYDRLAEVEPELS
FKKDDILYVDDTLPQGMFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDD
NTAKMLSAAARRSFFRRKHKHKRSGSKDSKDLLSLDTFSNDSIPLFEGKYSVSLAYQRVQ
KVDCTSLRPVLILGPLLDVVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYK
RRSGHFDVTTVASIKEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIRYKSAKHIKEQR
DPVYLRDKVTQRHSKEQFETAQKIDQEYSRYFTGVVQGGALSSICTQILAMVSQEQSKVL
WIPACPP
Download sequence
Identical sequences ENSRNOP00000061147 10116.ENSRNOP00000007828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]