SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061227 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061227
Domain Number 1 Region: 41-452
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.09e-104
Family AAT-like 0.0000000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061227   Gene: ENSRNOG00000016097   Transcript: ENSRNOT00000068567
Sequence length 457
Comment pep:known chromosome:RGSC3.4:3:9195737:9209545:-1 gene:ENSRNOG00000016097 transcript:ENSRNOT00000068567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSAAALSVHLMWPLWGRKAGASLTRCLHQSLTMTKRLQARRLDGIDQNLWVEFGKLTK
EYDVVNLGQGFPDFSPPDFATQAFQQATSGNFMLNQYTRAFGYPPLTNVLASFFGKLLGQ
EMDPLTNVLVTVGAYGALFTAFQALVDEGDEVIIMEPAFDCYEPMTMMAGGCPVFVTLKP
SPAPKGKLGASNDWQLDPAELASKFTPRTKILVLNTPNNPLGKVFSRMELELVANLCQQH
DVLCISDEVYQWLVYDGHQHVSIASLPGMWDRTLTIGSAGKSFSATGWKVGWVMGPDNIM
KHLRTVHQNSIFHCPTQAQAAVAQCFEREQQHFGQPSSYFLQLPQAMELNRDHMIRSLQS
VGLKLWISQGSYFLIADISDFKSKMPDLPGAEDEPYDRRFAKWMIKNMGLVGIPVSTFFS
RPHQKDFDHYIRFCFVKDKATLQAMDERLRKWKELQP
Download sequence
Identical sequences G3V827
ENSRNOP00000061227 ENSRNOP00000021865 XP_008759880.1.100692 10116.ENSRNOP00000021865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]