SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061495 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061495
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-66
Family SAICAR synthase 0.00012
Further Details:      
 
Domain Number 2 Region: 267-423
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.44e-40
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061495   Gene: ENSRNOG00000002101   Transcript: ENSRNOT00000063942
Sequence length 425
Comment pep:known chromosome:RGSC3.4:14:33492709:33509389:-1 gene:ENSRNOG00000002101 transcript:ENSRNOT00000063942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIIVLNIGRKLYEGKTKEVYELLDSPGRVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAGIKTAFTKKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYR
FYPPKVEMFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAIFEILEKSW
LPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVADRVELLLKSNSQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPITADWGAQ
DVWSSLRLPSGIGCSTILSPEGSAQFAAQIFGLNNHLVWAKLRASKLNTWISLKQADKKI
RECNL
Download sequence
Identical sequences 10116.ENSRNOP00000002890 ENSRNOP00000061495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]