SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061633 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061633
Domain Number 1 Region: 118-233
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 3.27e-34
Family Elongation factor TFIIS domain 2 0.0036
Further Details:      
 
Domain Number 2 Region: 21-89
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2.35e-20
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00041
Further Details:      
 
Domain Number 3 Region: 256-300
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000196
Family Transcriptional factor domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061633   Gene: ENSRNOG00000016288   Transcript: ENSRNOT00000064494
Sequence length 302
Comment pep:known chromosome:RGSC3.4:3:170831286:170839091:1 gene:ENSRNOG00000016288 transcript:ENSRNOT00000064494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVKSPCCDVGTSMQCSGNLSCGGAMDLLRELKNMPITLHLLQSTRVGMSVNALRKQSSDE
ELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSSKDASGTTDLSCKKPDPPRTSST
PRITTFPQVPITCDAVRNKCREMLTLALQTDHDHVAVGVSCEHLSSQIEEWVLKYLIFLD
VGNTDMKYKNRVRSRISNLKDAKNPGLRRNVLCGAITPQQIAVMTSEEMASDELKEIRKA
MTKEAIREHQMARTGGTQTDLFTCNKCRKKNCTYTQVQTRSSDEPMTTYVVCNECGNRWK
FC
Download sequence
Identical sequences 10116.ENSRNOP00000059673 ENSRNOP00000061633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]