SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061863 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000061863
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000449
Family PDZ domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061863   Gene: ENSRNOG00000042945   Transcript: ENSRNOT00000064038
Sequence length 32
Comment pep:known chromosome:RGSC3.4:10:39480977:39481141:-1 gene:ENSRNOG00000042945 transcript:ENSRNOT00000064038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRV
Download sequence
Identical sequences ENSRNOP00000061863 10116.ENSRNOP00000061863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]