SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062033 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062033
Domain Number 1 Region: 1446-1556
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-28
Family PDZ domain 0.019
Further Details:      
 
Domain Number 2 Region: 224-334
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-27
Family PDZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 341-453
Classification Level Classification E-value
Superfamily PDZ domain-like 8.41e-25
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1230-1329
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.023
Further Details:      
 
Domain Number 5 Region: 1697-1794
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-24
Family PDZ domain 0.004
Further Details:      
 
Domain Number 6 Region: 1066-1166
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-22
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 7 Region: 1557-1647
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-22
Family PDZ domain 0.003
Further Details:      
 
Domain Number 8 Region: 678-773
Classification Level Classification E-value
Superfamily PDZ domain-like 7.85e-22
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 9 Region: 109-221
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-21
Family PDZ domain 0.007
Further Details:      
 
Domain Number 10 Region: 5-64
Classification Level Classification E-value
Superfamily L27 domain 5.1e-21
Family L27 domain 0.0000355
Further Details:      
 
Domain Number 11 Region: 572-641
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000122
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062033   Gene: ENSRNOG00000007551   Transcript: ENSRNOT00000065197
Sequence length 1833
Comment pep:known chromosome:RGSC3.4:5:118969320:119110610:1 gene:ENSRNOG00000007551 transcript:ENSRNOT00000065197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPENPAAEKMQVLQVLDRLRGKLQEKGDTTQNEKLSAFYETLKSPLFNQILTLQQSIKQL
KGQLSHIPSDCSANFDFSRKGLLVFTDGSITNGNAHRPCSSITASESLPWTQRSGNEDFT
SVIQQMAQGRHIEYIDIERPSTGGLGFSVVALRSQSLGLIDIFVKEVHPGSVADRDQRLK
ENDQILAINDTPLDQNISHQQAIALLQQATGSLRLVVAREVGHTQSRTSTSSADTTLPET
VRWGHTEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGSTN
VQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPASLPVALPVVATRTLGSDSSP
FETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVA
VDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSLSASPFEQPSSREAVAEPPEVPELT
GSLKPETNSRMEAEEIGERLDNLRKDTVQALEKPDVYPEDIPGCPENELKSRWENLLGPD
YEVMVATLDTQIADDEELQKYSKLLPIHTLRLGMEVDSFDGHHYISSIAPGGPVDTLNLL
QPEDELLEVNGVQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRTVEPSLLE
AEVDRSVDVSTEDDDGELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPMRSVIVIRSL
VADGVAERSGELLPGDRLVSVNEFSLDNATLAEAVEVLKAVPPGVVHLGICKPLVKEEKE
EHFIFHSNNNGDNSESPETVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQFQQ
KDMDSSSEAWEMHEFLSPRLERRGEEREMLVDEEYEIYQDRLRDMEAHPPPPHIREPTSA
SPRLDLQAGPQWLHADLSGGEILECHDTESMMTAYPQEMQDYSFSTTDMMKETFGLDSRP
PMPSSEGNGQHGRFDDLEHLHSLVSHGLDLGMMTPSDLQGPGVLVDLPAVTQRREQEELP
LYRLPSARVVTKPSSHVGMVSSRHANAACELPEREEGEGEETPNFSHWGPPRIVEIFREP
NVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQN
ASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPSVNNKGKTPPQNQDQNTQEKKAKRHGTA
PPPMKLPPPYRAPSADTEESEEDSALTDKKIRQRYADLPGELHIIELEKDKNGLGLSLAG
NKDRSRMSIFVVGINPDGPAAADGRMRVGDELLEINNQILYGRSHQNASAIIKTAPTRVK
LVFIRNEDAVNQMAVAPFPVPSHSPSPVEDLGGTEPVSSEEDSSVDAKPLPERESSKPED
LTQAVDDSMVAEQEKASESPDSAARQMKQPGYSAQVSSSSQEIPSAPAPLCQSTHADVTG
SGNFQAPLSVDPAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHE
VYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVIYRDEAQYRDE
ENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGE
DVRQASQETVATILKCVQGLVQLEIGRLRAGSWASSRKTSQNSQGDQHSAHSSCRPSFAP
VITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGVSIAGGKGSPLGDIPIFIAM
IQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAIA
TQLEMMSAGSQLGSPTADRHPQDPEELLQRTAD
Download sequence
Identical sequences 10116.ENSRNOP00000010211 ENSRNOP00000062033 ENSRNOP00000010211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]