SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062059 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062059
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily L domain-like 3.91e-26
Family U2A'-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062059   Gene: ENSRNOG00000021168   Transcript: ENSRNOT00000065806
Sequence length 260
Comment pep:known chromosome:RGSC3.4:2:190715685:190730203:1 gene:ENSRNOG00000021168 transcript:ENSRNOT00000065806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMKKKINMELKNRAPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL
PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL
FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEEEDEDQDGDEDEEDEEEDE
AGPPEGYEDEDEDEDEAGSEVGEGEEEVGLSYLMKEEIQDEEDDDDYVDEGEEEEEEEEE
GPRGEKRKRDAEDDGEEDDD
Download sequence
Identical sequences ENSRNOP00000062059 10116.ENSRNOP00000062059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]