SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062066 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062066
Domain Number 1 Region: 14-268
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.04e-46
Family FCH domain 0.0047
Further Details:      
 
Domain Number 2 Region: 436-498
Classification Level Classification E-value
Superfamily SH3-domain 9.19e-24
Family SH3-domain 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000062066
Domain Number - Region: 302-355
Classification Level Classification E-value
Superfamily HR1 repeat 0.0379
Family HR1 repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062066   Gene: ENSRNOG00000006611   Transcript: ENSRNOT00000067161
Sequence length 502
Comment pep:known chromosome:RGSC3.4:3:51285541:51356751:1 gene:ENSRNOG00000006611 transcript:ENSRNOT00000067161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLTDCSYNKVYKSLKEFAQNGDNFCKQITSVLQQRANLEISYAKGLQKLAVKLSKAL
QSTKKNCLSTAWAWASESMKSAADLHQKLGKAIELEAIKPTHQVLSMQEKKRKSLDNEVE
KSANLVINNWNQQIKAKKKLMMSTKKHEALFHLIESSKQSMTQKEKQKLLNKLKKSTEKL
EKEDESYYQKNMAGYSTRLKWESTLEKCYKSMLELEKERIQLLCNNLNQYSQHISLFGQT
LTTCHTQIHCAISKVDVEKDIQALMEETAVLSLENKSELLLADYFEEDPKNPMDKERRKS
LIKPKLWRLQKDIEKASRDKEGLEQKLKALASSASFSDAKSQKDAETLMDESPLKTILVQ
VNTYFLSCSLCDVDNRSTILKPTTNTELAYSEQEHSHSYVKISRPLLTKRLEKAESKAPA
GEQNNPSSSRPGSSVSQGNNQLCKALYTFQARQDDELNLEKGDIVTIHEKKEEGWWFGSL
NGKKGHFPAAYVEELPPKAGQA
Download sequence
Identical sequences ENSRNOP00000062066 10116.ENSRNOP00000062066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]