SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062133 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062133
Domain Number 1 Region: 326-531
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-59
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 164-311
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-30
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 78-181
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-21
Family PDZ domain 0.00096
Further Details:      
 
Domain Number 4 Region: 31-82
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000104
Family L27 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062133   Gene: ENSRNOG00000018760   Transcript: ENSRNOT00000067799
Sequence length 536
Comment pep:known chromosome:RGSC3.4:17:64054967:64282554:-1 gene:ENSRNOG00000018760 transcript:ENSRNOT00000067799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGEKSLHSLVKIHEKLHYYEKQSPVPILHGAAALADDLADELQNKPPNSEIRELLKLLS
KPNVKALLSVHDTVAQKSYDPVLPPMPDDIDDEEDSVKIIRLVKNREPLGATIKKDEQTG
AITVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIQILSQSQGAITFKIIPST
KEEIPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQDDATWWQAKHEGD
TNPRAGLIPSKHFQERRLALRRPEIVVQPLKLSNRKSSGFRRSFRLSRKDKKTNKSMYEC
KKSEQYDTADVPTYEEVTPYRRQTHDKYRLVVLVGPVGVGLNELKRKLLMSDTQHYGVTV
PHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNK
VCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGTAKPFTEED
FQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFDKLETDAHWVPVSWLHS
Download sequence
Identical sequences ENSRNOP00000062133 10116.ENSRNOP00000025458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]