SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062391 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062391
Domain Number 1 Region: 25-178
Classification Level Classification E-value
Superfamily UBC-like 2.32e-44
Family UBC-related 0.0000000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062391   Gene: ENSRNOG00000019749   Transcript: ENSRNOT00000064699
Sequence length 271
Comment pep:known chromosome:RGSC3.4:5:172787379:172796391:1 gene:ENSRNOG00000019749 transcript:ENSRNOT00000064699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQAKALDSARKMSSNSNKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVV
RGPEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPA
WSVSTILTGLLSFMVEKGPTLGSIETSDFTKKQLAAQSLVFNLKDKVFCELFPEVVEEIK
QKQKAQDELSNRPQNLPLPDVVPDGEMHRGQNGIQLLNGHAPAAGPNLAGLPQANRHHGL
LGGALANLFVIVGFAAFAYTVKYVLRSIAQE
Download sequence
Identical sequences A0A0G2K8C5
NP_001007656.2.100692 NP_001007656.2.4139 XP_006239616.1.100692 XP_006239617.1.100692 XP_008762576.1.100692 ENSRNOP00000062391 10116.ENSRNOP00000026752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]