SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063181 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063181
Domain Number 1 Region: 362-447
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000499
Family PDZ domain 0.037
Further Details:      
 
Domain Number 2 Region: 836-885
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063181   Gene: ENSRNOG00000009460   Transcript: ENSRNOT00000068082
Sequence length 1152
Comment pep:known chromosome:RGSC3.4:1:265825444:265883170:-1 gene:ENSRNOG00000009460 transcript:ENSRNOT00000068082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLLMILASAVLGSFLTLLTQFLLLYRRQPEPRADEAARAGDGFRYLKPVPGLPLREYL
YGGGAEEPAAGSSEAGASTTPTPDSPAPPTLETCYFLNATILFLFRELRDTALARRWVTK
KIKVEFEELLQTKTAGRLLEGLSLRDVFLGDTVPYIKTIRLVRPVVASGTGEPDEPDGDA
LPATCPEELAFEAEVEYNGGFHLAIDVDLVFGKSAYLFVKLSRVVGRLRFVLTRVPFTHW
FFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPSYKIRFKPFFPYQAL
QGFEEDEDLIHIQQWALTEGRLKVTLLECSRLLIFGSYEREANVHCTLELSSGVWEEKQR
SSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQRGDRLIAIGG
VKITSTLQVLKLIKQAGDRVLVYYQRPVGQSNQGAMLQDSLGQLEENFLSSSCQPGYEEE
AAGLPVDSETRDLDSEFEDLAGDVRVQTELKEETQPLSHSPKRTPTTLSIKPLGAISPVL
NRKLISGIHPPPQKLPSKEGNKPSTLKTSEATEAAQVSKPQVPTFKPPVPPRPQGRVPLP
PTDTSAQADPETTEKPEKVLLPPPPADKPAEKQVKSVDHGEDVAAGKQPPAKQEVVKDAP
SESSAPTKDPSDDHQMWESSEVLYRNKVGKWSRARASCVFDIEACHRYLNIALWCRDPFK
LGGLICLGHASLKLEEVALGCLATSNMEYLSKFRLEPPAPKAMVTRTALRNLSMQKGFND
KFCFGDITIHFKYLKEGEPDHQIVPSVEKERELHVVEEVSTLPKEDHFVGQMSLSENKHS
FQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETPLCGATERRVDRTL
KSLRLEGQDPLLGLPPRVEMEANKSVNKTTGLTRHIINTSSRLLNLRQVSKTRLAEPGTD
LVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNSAGIKLTRKEGGLDDSVFIAVKEIGRD
LYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETNDTRKKSVLSASLAKSGE
RLQALTLLMIHYKAGIEDIETLENLSLDQHSKKMNKYTEDTEEDLDSEISQLIDSQPFSN
ISDDLFGPSESV
Download sequence
Identical sequences D3ZXY2
10116.ENSRNOP00000063181 ENSRNOP00000063181 NP_001100916.1.100692 NP_001100916.1.4139 ENSRNOP00000063181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]