SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063412 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063412
Domain Number 1 Region: 519-617
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.000000000000144
Family Anticodon-binding domain of PheRS 0.014
Further Details:      
 
Domain Number 2 Region: 42-132
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000573
Family TrmB-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063412   Gene: ENSRNOG00000010743   Transcript: ENSRNOT00000064808
Sequence length 617
Comment pep:known chromosome:RGSC3.4:8:54125926:54130147:1 gene:ENSRNOG00000010743 transcript:ENSRNOT00000064808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPRRLLLVGEGNFSFAASLIDGLDPDVSVTATGFQHRADLEGDPVALENLRRLRERGVE
VRFGVDCTQLADEREFDRIYFNFPHCGRKAGVAKNRELLAKFFQSCADVLAKEGEVHVAL
CRGQGGTPADKPQREWHNSWQVVAMAALGGLILSDVCPFSCEAVPGYKCTGYRSQDRPFH
IEGALTYIFTQSLPFESSRPRTFRVRLEDRWFYFTEPEALLGKLNRRFLEAPSCHPIRTI
NEKLIAELGKTFPLKRLRCPLPLLSQGGPSVLPPVACDLLPTFWICLHEDSSCSELLNGE
ITEDMEEIPDSGSECTLPKSPARDGCKAAQEGVCEQVKLRLRPSLLVHAEPVIHSPEFLP
GSLYVLSGPVFRKCHILPFTMPAFHETLFILGFNRNTKESCLLPLLDHLKDTLGNFLTQT
LQEDSSLSTSVDFVLQPNGKDYVIHVKSLDFGPDCTENLIIGSIVTSTIVKHKHQCFVFV
SINLDLLVMLAYDISDWRILWTFDNRFLKRFAPGKIEHFKSYSLYPPCYVHDVSFWLDEK
NTFDELEFHTVARAVSRDTIVSIQFLDRFQHPETQQVSLCYRLTYQTCDKALTPQLAAAM
QSQFRKEIQRELHVSPR
Download sequence
Identical sequences 10116.ENSRNOP00000014424 ENSRNOP00000063412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]