SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063421 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063421
Domain Number 1 Region: 45-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-34
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 174-315
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-34
Family Pleckstrin-homology domain (PH domain) 0.00066
Further Details:      
 
Domain Number 3 Region: 335-445
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.24e-29
Family DEP domain 0.003
Further Details:      
 
Domain Number 4 Region: 430-559
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.41e-27
Family DEP domain 0.0012
Further Details:      
 
Domain Number 5 Region: 630-695
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000421
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 534-625
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000329
Family PDZ domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063421   Gene: ENSRNOG00000005391   Transcript: ENSRNOT00000064774
Sequence length 1559
Comment pep:known chromosome:RGSC3.4:5:7404475:7661411:-1 gene:ENSRNOG00000005391 transcript:ENSRNOT00000064774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQAFLHRMNQCAAAKLDKNVTEETVKVSMSAPLELLFVTKLMKPFEKMMKNKVSSQMKLC
VCFHLKDKFRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLV
TPIQRICKYPLLLKELLKRTPRKHSDYTAVMEALQAMKAVCSNINEAKRQMEKLEVLEEW
QAHIEGWEGSNITDTCTEMLMCGVLMKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKA
STDGHRYVFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKSPE
EKHEWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFP
KCFLGSEFVSWLLEIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDG
TFYPRSEMQDVISKGVRLYCRLHSLFTPVVRDKDYHLRTYKSVVMANKLIDWLIAQGDCR
TREEAMIFAVGLCDNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVE
NVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFLR
PFPEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTV
AAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYKRPMKQDSIQWVYDSLESAQED
IQKSHSKPPGDEAGDVFDCKVEDVMDKFNTLAIIDGKKEHVSLTVDNVHLEYGVVYEYDS
TAGTKCNVVEKMVEPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIATDLQSKFTS
MCSERVEHVCHRISSYGRFSRVLKNRAWPTFKQAKAKMSPLHSSDFCPTNCHVNVMEVSY
PKASASLGSAFGVQLDSRKHNSHDKENRSADPGKLSPMVYIQHTITTMAAPSGLSLGHKD
GHGLRYLLKEEDLETQDIYHKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTTEY
VIPTDSDNEKGERNSKRVCFNVAGDEQEDSGHDTVSNRDSYSDCNSNRNSIASFTSICSS
QCSSYFHSDEMDSGDELPTSIRISHDKQDKIHTCLEQLFIQLDSITNLLKGRAVVRAFEQ
TKYLTPGRGLQEFQQEMEAKLSCPRRLRLHLKQDPWNLPSGVRALAQSFRKYVEEVKCRI
LLALLEYSDSETQLRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRW
LDQIANAGVLFHFQSLLSPNLKDEQAMLEDTLVALFDLEKVSFFFKPSEEEPLVANVPLT
YQVEGSRQALKVVFYMDSYHFEQLPQRLKNGGGFKIHPVLFSQALESMEGYCYRDNISVE
EFQAQINTASLEKVKQYNQKLRAFYLDKSNSPPNATSKAAYIEKLMRPLNALDELYRLVT
SFIRSKRIAACVNTPCSASGVGLLSVSSELCDRLGACHIIMCSSGVHRCTLSVTLEQAIT
LARSHGLPPRYIMQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPVGDE
Download sequence
Identical sequences 10116.ENSRNOP00000033454 ENSRNOP00000063421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]