SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063630 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063630
Domain Number 1 Region: 17-99
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000423
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063630   Gene: ENSRNOG00000018369   Transcript: ENSRNOT00000068612
Sequence length 1383
Comment pep:known chromosome:RGSC3.4:1:82577850:82597982:1 gene:ENSRNOG00000018369 transcript:ENSRNOT00000068612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARSRSAEELRRAELVEIIVETEAQTGVSGFNVAGGGKEGIFVRELREDSPAAKSLSLQ
EGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEMKGP
RAKVAKLNIQSLSPVKKKKMVIGTLGTPADLAPVDVEFSFPKFSRLRRGLKADAVKGPVP
AAPARRRLQLPRLRVREVAEEAQVARMAAAAPPSRKAKSEAEVATGAGFTAPQIELVGPQ
LPSAEVGVPKVSVPKGTPSTEAASSFALHLPTLGLGAPAAPAVEPPTTGIQVPQVELPTL
PSLPTLPTLPCLDTQEGAAVVKVPTLDVAAPSVEVDLALPGAEVEAQGEVPEVALKMPRL
SFPRFGVRGKEATEAKVVKGSPEAKAKGPRLRMPTFGLSLLESRPSGPEAAAESKLKLPT
LKMPSFGISVAGPEVKAPKGPEVKLPKVPEIKLPKAPEAAIPDVQLPEVQLPKMSDMKLP
KIPEMAVPDVHLPEVKLPKVPEMKVPEMKLPKIPEMAVPDVHLPDIQLPKVPEMKLPDMK
LPKVPEMAVPDVHLPDIQLPKVPEMKLPDMKLPKVPEMAVPDVRIPEVQLPKVSEVKLPK
IPDMAVPDVRLPELQLPKMSEVKLPKIPDMAVPDVRLPEVQLPKVSELKLPKVPEMTMPD
IRLPEVQLPKVPDIKLPEIKLPKVPEMAVPDVPLPELQLPKVPQVPDVHLPKVPEMKLPK
VPEAQRKSAGAEQAEKTEFSFKLPKMTVPKLGKVTKPGEAGIEVPDKLLILPCLQPEVGT
EVAHVGVPSLSLPSVELDLPGALGLEGQVQEAVSGKVEKPEGPRVAVGTGEAGFRVPSVE
IVTPQLPTVEVEKEQLEMVEMKVKPTSKFSLPKFGLSGPKAVKAEAEGPGRATKLKVSKF
AISLPRARAGTDADAKGAGEAGLLPALDLSIPQLSLDAQLPSGKVEVAGAESKPKGSRFA
LPKFGAKGRDSEADVLVAGEAELEGKGWGWDGKVKMPKLKMPSFGLSRGKEAEIQDGRVS
PGEKLEAIAGQLKIPEVELVTPGAQETEKVTSGVKPSGLQVSTTRQVVAEGQEGAQRVSS
LGISLPQVELASFGEAGPEIAAPSAEGTVGSRIQVPQVMLELPGTQVAGGDLLVGEGIFK
MPTVTVPQLELDVGLGHEAQAGETAKSEGGLKLKLPTLGAGGKGEGAEAQSPEAQHTFHI
SLPDVELTSPVSSHAEYQVVEGDGDGGHKLKVRLPLFGLARAKEGIETGEKVKSPKLRLP
RVGFSQSESASGEGSPSPEEEEEGSGEGASGRRGRVRVRLPRVGLASPSKGSKGQEGDAA
SKSPVGEKSPKFRFPRVSLSPKARSGSKDREEGGFRVRLPSVGFSETAAPGSARIEGTQA
AAI
Download sequence
Identical sequences G3V8D2
XP_017445252.1.100692 XP_017445253.1.100692 10116.ENSRNOP00000024771 ENSRNOP00000063630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]