SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063789 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063789
Domain Number 1 Region: 1122-1227
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-27
Family PDZ domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 411-518
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-25
Family PDZ domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 905-1012
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-23
Family PDZ domain 0.00001
Further Details:      
 
Domain Number 4 Region: 755-863
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-22
Family PDZ domain 0.0000147
Further Details:      
 
Domain Number 5 Region: 125-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.71e-21
Family Nucleotide and nucleoside kinases 0.0078
Further Details:      
 
Domain Number 6 Region: 585-690
Classification Level Classification E-value
Superfamily PDZ domain-like 1.12e-18
Family PDZ domain 0.0000128
Further Details:      
 
Domain Number 7 Region: 9-106
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000158
Family PDZ domain 0.041
Further Details:      
 
Domain Number 8 Region: 299-336
Classification Level Classification E-value
Superfamily WW domain 0.000000000000668
Family WW domain 0.0013
Further Details:      
 
Domain Number 9 Region: 346-381
Classification Level Classification E-value
Superfamily WW domain 0.00000000195
Family WW domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063789   Gene: ENSRNOG00000013962   Transcript: ENSRNOT00000063877
Sequence length 1261
Comment pep:known chromosome:RGSC3.4:4:9909441:10547887:-1 gene:ENSRNOG00000013962 transcript:ENSRNOT00000063877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVTNMEKASIEPPEEEEEERP
VVNGNGVVITPESSEHEDKSAGASGETPSQPYPAPVYSQPEELKDQMDDTKSTKPEENED
SDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPAEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPADGQLDGTYPPPVHDDNVSVASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPVGSETSLIIHRGGFFSPWKTPKPMVDRWENQGSPQTSLSAPAVPQSLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGNSPDYKELD
VHLRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTH
RYVIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYANSNH
AAPSSNASPPEGFASHSLQTSDVIIHRKENEGFGFVIISSLNRPESGATITVPHKIGRII
DGSPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSA
PSSEKQSPMAQQHSPLAQQHSPLAQPSPATPNSPVAQPAPPQPLQLQGHENSYRSEVKAR
QDVKPDIRQPPFTDYRQPPLDYRQPPGGDYSQPSPLDYRQHSPDTRQYPLSDYRQPQDFD
YFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGESTRD
MTHARAIELIKSGGRRVRLLLKRGTGQVPEYGMVPSSLSMCMKSDKHGSPYFYLLGHPKD
T
Download sequence
Identical sequences 10116.ENSRNOP00000036634 ENSRNOP00000063789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]