SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063796 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063796
Domain Number 1 Region: 143-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 2 Region: 67-182,277-283
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000251
Family Growth factor receptor domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063796   Gene: ENSRNOG00000000436   Transcript: ENSRNOT00000068712
Sequence length 291
Comment pep:known chromosome:RGSC3.4:20:4235508:4237859:1 gene:ENSRNOG00000000436 transcript:ENSRNOT00000068712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWAGCCIFLRGFSFLLVLMTEGAKGGPFKERMGVCSKQTLLVPLRYNESYSQPVYRPY
LTLCAGRRICSTYRTTYRVAWREVRREVQQTHVVCCQGWKKPHPGALTCEAICSKPCLNG
GVCAGPDQCECASGWAGKHCHVDVDECRTSLTLCSHGCLNTLGSFTCSCPNPLVLGPDGR
ACAGGPPESSTSAGILSVAVREADSEEHALRREVAELRGRLERLEQWATQAGAWVRAVLP
VAPEDLRPEQVAELWGRGDRIESLSDQVLLLEERLGACSCEDNSLGPGLHG
Download sequence
Identical sequences 10116.ENSRNOP00000000499 ENSRNOP00000063796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]