SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000063862 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000063862
Domain Number 1 Region: 223-674
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 9.68e-177
Family Class I alpha-1;2-mannosidase, catalytic domain 0.000000000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000063862   Gene: ENSRNOG00000012559   Transcript: ENSRNOT00000068758
Sequence length 676
Comment pep:known chromosome:RGSC3.4:3:3493439:3514882:1 gene:ENSRNOG00000012559 transcript:ENSRNOT00000068758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLGFLTPPASEVSWASFAVMYPPPPAPAPHRDFISVTLSLGESYDNSKSRRRRSCWRKWK
QLSRLQRNVILFVLGFLILCGFLYSLQVSDQWKALSGSRAEVEKMKLEVLPVLPAPQKES
AEPEGFADILSQKRQRHLRRGPPHLQIRPPNTVSKDGMQDDAKEREAALGKAQQEENTQR
TVISWRGAVIEPEQATEPPSKRAEASIKPLFLASRIWKEPAPPNERQKGVIEAFLHAWKG
YQKFAWGHDELKPVSKTFSEWFGLGLTLIDALDTMWILGLKQEFKEARKWVSENLDFQKN
VDVNLFESTIRILGGLLSAYHLSGDSLFLSKAEDFGNRLMPAFTTPSKIPYSDVNIGTGF
AHSPQWTSDSTVAEVTSIQLEFRELSRLTGIKKFQEAVEEVTKHIHSLSGKKDGLVPMFI
NTNSGLFTHPGVFTLGARADSYYEYLLKQWIQGGKKETQLLEDYVRAIEGIKAHLLRQSQ
PRKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVHHGLPADHMDLARALMETCYQMNQQM
ETGLSPEIAHFNMYPRADHKDVEVKPADRHNLLRPETVESLFYLYRVTKDRKYQDWGWEI
LQSFNKYTRVPSGGYSSINNVQNSHKPEPRDKMESFFVGETLKYLYLLFSDDLELLGLDT
CVFNTEAHPLPIWSPA
Download sequence
Identical sequences 10116.ENSRNOP00000016846 ENSRNOP00000063862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]