SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000000747 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000000747
Domain Number 1 Region: 31-244,358-395
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.8e-59
Family Inositol polyphosphate kinase (IPK) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000000747   Gene: ENSRNOG00000000609   Transcript: ENSRNOT00000000747
Sequence length 396
Comment pep:known chromosome:RGSC3.4:20:17956194:17982280:-1 gene:ENSRNOG00000000609 transcript:ENSRNOT00000000747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEPPALRLRPPGSTGDSPPVPRLLGGCVPLSHQVAGHMYGKDKVGILQHPDGTVLKQL
QPPPRGPRELEFYTMVYAADCADAVLLELRKHLPKYYGVWSPPSAPNDVYLKLEDVTHKF
NKPCIMDVKIGRKSYDPFASAEKIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQH
YGRGLTKETLKEGVSKFFHNGFCLRKDAVAASIQKVEKILQWFENQKQLNFYASSLLFVY
EGSSQPATTKSNDRTLAGRFLSKGALSDADVLECNNNFHLFSSPANGTSVGKSLSKAYSR
HRKLYAKKHQSQTSLKVETLEQDNGWKSMSQEHLNGNVLSQLEKVFYHLPAGRQEIAEAE
VRMIDFAHVFPSNTVDEGYVYGLKHLIAVLRSILDS
Download sequence
Identical sequences Q99NI4
ENSRNOP00000000747 NP_599244.1.100692 NP_599244.1.4139 10116.ENSRNOP00000000748 ENSRNOP00000000748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]