SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001685 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001685
Domain Number 1 Region: 182-334
Classification Level Classification E-value
Superfamily Cap-Gly domain 5.76e-43
Family Cap-Gly domain 0.0000000807
Further Details:      
 
Domain Number 2 Region: 38-132
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.28e-34
Family Cap-Gly domain 0.00000299
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000001685
Domain Number - Region: 777-886
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000445
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number - Region: 1352-1386
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00698
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001685   Gene: ENSRNOG00000001247   Transcript: ENSRNOT00000001685
Sequence length 1391
Comment pep:known chromosome:RGSC3.4:12:34049773:34155526:1 gene:ENSRNOG00000001247 transcript:ENSRNOT00000001685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLKPSGLKAPTKILKPGSTALKTPAAAAAPLEKTVPSEKASGPPSSETQEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLTRKVQAEDEANGLQTAHARAASPLSTAAATMVSSSPATPSNIPQKPSQPVAKETSA
TPQISNLTKTASESISNLSEAGSVKKGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEW
CGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKAAAVRRVMA
TTPASLKRSPSASSLSSMSSVASSVSSKPSRTGLLTETSSRYARKISGTTALQEALKEKQ
QHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLELEAKMDQLRTMVEAAD
REKVELLNQLEEEKRKVEDLQFRVEEESITKGDLEVATVSEKSRIMELEKDLALRVQEVA
ELRRRLESSKPPGDVDMSLSLLQEISALQEKLEVTHTDHQNEVTSLKDHFGTREEMFQKE
IKALHAATEKLSKENESLRSKLDHANKENSDVIALWKSKLETAIASHQQAMEELKVSFSK
GIGTDSAEFAELKTQIERLRLDYQHEIESLQSKQDSERSAHAKEMESMKAKLMKIIKEKE
DSLEAVKARLDTAEDQHLVEMEEMLSKLQEAEIKVKELEVLQAKYSEQTQVVGHLTSQLS
VVEEQLLDLDALRKANSEGKLEIETLRQQLEGAEKQIKNLEMERNAESSKANSITKDLQG
KELMLTSLQSNLNEVNQVKETLEKELQTLKEKFASASEEAVSTQTSMQDTVNKLHQKEEQ
FNMLSSELEKLRENLTDMEAKFKEKDEREDQLVKAKEKLENDIAEIMKMSGDNSSQLTKM
NDELRLKERSVEELQLKLTKANENASLLQKSIGEVTLKAEQSQQEAAKKHEEEKKELENK
LLELEKKMETSHYQCQDLKAKYEKASSETKIKHEEILQNFQKMLVDTEDKLKAAQEANRD
LMQDMEELKSQADKAKAAQTAEDAMQIMEQMTKEKTETLASLEDTKQTNAKLQSELDTLK
ENNLKTVEELNKSKELLNEENQKMEEFKKEIETLKQAAAQKSQQLSALQEENVKLAEELG
RTRDEVTSHQKLEEERSVLNNQLLEMKKRESEYRKDADEEKASLQKSISLTSALLTEKDA
ELEKLRNEVTVLRGENASAKSLHSVVQTLESDKVKLELKVKNLELQLKENKRQLSSSSGN
TDVQTEEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGEDPNSYDSDDQ
EKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRSEERPYCEICEMFGH
WATNCNDDETF
Download sequence
Identical sequences 10116.ENSRNOP00000001683 ENSRNOP00000001685 XP_008767481.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]