SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000001899 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000001899
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 2.27e-40
Family Internalin LRR domain 0.042
Further Details:      
 
Domain Number 2 Region: 540-634
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.8e-26
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000001899   Gene: ENSRNOG00000001402   Transcript: ENSRNOT00000001899
Sequence length 686
Comment pep:known chromosome:RGSC3.4:12:19694434:19705423:1 gene:ENSRNOG00000001402 transcript:ENSRNOT00000001899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAGPLAAGGEEAAASVSVPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSSLPPYICQLPLRVLIISNNKLGALPPDISTLGSLRQLDVSSNELQSLPVELCS
LRSLRDLNVRRNQLSTLPDELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQICLKGKLHIFKYLTMEAGRRGAALGDLVPSRPPSFSPCPAEDLFPGRRYDGGLDS
GFHSVDSGSKRWSGNESTDDFSELSFRISELAREPRGPRQPREDGSGDGDLEQIDFIDSH
VPGDDEQSAAEVRTQEPLPSELSLAAGDMERPSSSRREEPAGEERRRPDTLHLWQERERR
LQQQSGAWGPSKKDSIPKRGIRATGAGASAPSTQTACNGPPKSSAAQLGVSGEQGAPTLP
STSQDPLPVSGPVTAPVPRPLGSIQRPNSFLFRSSSQSGSSPSSPESVLRPRPFPQILEE
KELISQLRQILESRLQQPLPEDLAEALANGVILCQLANQLRPRSVPFIHVPSPAVPKLSA
LKSRKNVENFLEACRKMGVPEADLCSPSDLLRGTAQGLQTILEAVILAGGKAPVPVQPPS
GLGGFLLFYVVSMLLLYVVYTRLLGS
Download sequence
Identical sequences E9PSW6
ENSRNOP00000001899 10116.ENSRNOP00000001899 ENSRNOP00000001899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]