SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000002188 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000002188
Domain Number 1 Region: 102-186
Classification Level Classification E-value
Superfamily E set domains 0.000000000385
Family Filamin repeat (rod domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000002188
Domain Number - Region: 356-538
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0256
Family Rhamnogalacturonan acetylesterase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000002188   Gene: ENSRNOG00000001608   Transcript: ENSRNOT00000002188
Sequence length 559
Comment pep:known chromosome:RGSC3.4:11:45714387:45770951:1 gene:ENSRNOG00000001608 transcript:ENSRNOT00000002188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTNFFKLRVFCYLFVVLMVVVLVFNVTQVEYLDHETISETFIDSSGQYISSQATGFSRN
AYCGYEHQTLSSQERLEEDALLAASKWKVPDVDLVPFVKSTDPSSSYFVILNSAAFFRVG
SQLEVLVHVQDFRGKPKKYGGDYLQARIHSPELQAGAVGRVVDYQNGFYKVFFTLLWPGR
VRVSISLVHPSEGIRVLQRLQEEKPDRVYFKSLFRSGRISETMKCNVCLPGSLPLCNFTD
RYTGEPWFCFKPKKLPCSSRINHFKGGYTKGLLTAAESAFFQSGVNIKMPINSSGPDWVT
VISRRIKETDDPEVSQDSGTFPSGYFYKDQWRPRRFKMRHFNDPDNITECLQRKMVYLFG
DSTARQWFEYLTTFVPDLVEFNLGSPKNVGPFLAVDQKHDILLKYRCHGPPIRFTSVFSN
DLHYVANELNRIVGGKNTVVAIAVWSHFSTFPLEVYIRRLRNIRRAVVQLLDRSPKTVIV
VRTGNAQELGPEVSLYNSDWYNFQLDTVLRRMFSGVGVYLVDAWEMTLAHHLPHKLHPEE
VIVKNQLDMFLSYVCPSET
Download sequence
Identical sequences D4ACA1
ENSRNOP00000002188 NP_001102905.1.100692 NP_001102905.1.4139 XP_006248314.1.100692 XP_006248315.1.100692 XP_017453559.1.100692 ENSRNOP00000002188 10116.ENSRNOP00000002188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]