SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000004798 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000004798
Domain Number 1 Region: 2-139
Classification Level Classification E-value
Superfamily MAPEG domain-like 8.24e-45
Family MAPEG domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000004798   Gene: ENSRNOG00000003606   Transcript: ENSRNOT00000004798
Sequence length 152
Comment pep:known chromosome:RGSC3.4:14:21105778:21106372:1 gene:ENSRNOG00000003606 transcript:ENSRNOT00000004798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLSKEYGFVLLTGAASFMMVLHLAINLGKARKKYKIEYPVMYSTDPENGYMFSCIQRA
HQNTLEVYPPFLFFLTVGGVYHPRIASGLGVAWIIGRVLYAYGYYTGDPSKRYQGAVSSL
ALFALMGTTVCSAFQHLGWIKPGLGSGSRSCH
Download sequence
Identical sequences ENSRNOP00000004798 10116.ENSRNOP00000004798 ENSRNOP00000004798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]