SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000005920 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000005920
Domain Number 1 Region: 156-525
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.61e-95
Family GABA-aminotransferase-like 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000005920   Gene: ENSRNOG00000004443   Transcript: ENSRNOT00000005920
Sequence length 563
Comment pep:known chromosome:RGSC3.4:3:127691668:127825206:1 gene:ENSRNOG00000004443 transcript:ENSRNOT00000005920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANPRDSAVTNGTLRNPKTQPGKRQSTDCVKNGISKEAQQNRKAEEDDKLVFKPYPEPPL
YVFVFTYMGYGIGMLFGYLRDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYTRNLYM
RIRDSWSHTVCSVPVPNFDIMEKVTDDYNWTFRHTGKVIKNVINMASYNYLGLASKYNES
MEKVKDTIEKYGVGVASTRNEMGSLDIHNELEDLMAKFLNVEAVMVFGMGFATNSTNIPI
FVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNIQNLEKLLREAIIRGQPRTGRAWK
KILILVEGVYSMEGSIVNLPQIVALKKKYKAYLYMDEAHSIGCTGTMGQGIRELFGLAPE
DIDIYMGTFTKSFAASGGYIAGKKEIVDYVRVQSHSATYATSMSPVVAAQIIRSLKIMMG
YEGNFGGVQRIQQLRENIKYFRRRLIEMGFIIYGNDYSPVVPVLLYMPAKVSAFGRLLLK
KKIAVVVVGFPATSLPEGRARFSLSSAHTREMLDTVLEVVDKIGDLLNVKYFPYKKSGRA
VLYNKENFDNEASFEEKSSEPEA
Download sequence
Identical sequences D4A9V0
ENSRNOP00000005920 NP_001099987.1.100692 NP_001099987.1.4139 10116.ENSRNOP00000005920 ENSRNOP00000005920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]