SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000006240 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000006240
Domain Number 1 Region: 449-816
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-103
Family Hect, E3 ligase catalytic domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 67-172
Classification Level Classification E-value
Superfamily E set domains 0.00000000173
Family Filamin repeat (rod domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000006240   Gene: ENSRNOG00000004382   Transcript: ENSRNOT00000006240
Sequence length 823
Comment pep:known chromosome:RGSC3.4:6:108963520:108988541:-1 gene:ENSRNOG00000004382 transcript:ENSRNOT00000006240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYVIGGIIVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLREEHNYSLSIHELGPQEEENSEVSFEKSVTSNRQT
CQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSENEKNIVERNVSTSGVSIYFEAY
LYNANSYSSAPWHLPPMHMSSSQRRPSTALEEEEEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTSQLFTRFSDNNQALVHPN
PNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFET
DDPEFYKSKVCFILNNDMSEMELVFAEEKYNKSGQLDKIVELMTGGAQTPVTNANKTFYL
NLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDISVSDFKAHAV
VVGGSWHFREKVMRWFWTVVSSLTQEELARLLQFTTGSSQLPPGGFAALCPSFQIIAAPT
HSTLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGFGML
Download sequence
Identical sequences D3ZVC4
NP_001100214.1.100692 NP_001100214.1.4139 XP_006240395.1.100692 XP_008762976.1.100692 XP_017449585.1.100692 10116.ENSRNOP00000006240 ENSRNOP00000006240 ENSRNOP00000006240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]