SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007247 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007247
Domain Number 1 Region: 184-457
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.52e-94
Family Inositol polyphosphate kinase (IPK) 0.0000000000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007247   Gene: ENSRNOG00000005284   Transcript: ENSRNOT00000007247
Sequence length 459
Comment pep:known chromosome:RGSC3.4:3:106257482:106266160:1 gene:ENSRNOG00000005284 transcript:ENSRNOT00000007247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLPGHPTGMARPRGAGPCSPGLERAPRRSVGELRLLFEARCAAVAAAAAAGEPRARGAK
RRGGQVPNGLPRAAPAPVIPQLTVTSEEDVAPASPGPPDREGNWLPAAGSHLQQPRRLST
SSLSSTGSSSLLEDSEDDLLSDSESRSRGNVQLETSEDVGQKSHWQKIRTMVNLPVMSPF
KKRYSWVQLAGHTGSFKAAGTSGLILKRSSEPEHYCLVRLMADVLRGCVPAFHGVVERDG
ESYLQLQDLLDGFDGPCVLDCKMGVRTYLEEELTKARERPKLRKDMYKKMLAVDPEAPTE
EEHAQRAVTKPRYMQWREGISSSTTLGFRIEGIKKADGSCSTDFKTTRSREQVTRVFEEF
MQGDAEVLKRYLNRLQQIRDTLEISDFFRRHEVIGSSLLFVHDHCHRAGVWLIDFGKTTP
LPDGQILDHRRPWEEGNREDGYLLGLDNLIGILANLAER
Download sequence
Identical sequences P17105
NP_112307.2.100692 NP_112307.2.4139 ENSRNOP00000007247 10116.ENSRNOP00000007247 ENSRNOP00000007247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]