SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000007608 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000007608
Domain Number 1 Region: 3887-4018
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-36
Family Synaptotagmin-like (S variant) 0.00000264
Further Details:      
 
Domain Number 2 Region: 4192-4326
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.1e-20
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 3691-3787
Classification Level Classification E-value
Superfamily PDZ domain-like 3.37e-19
Family PDZ domain 0.0000069
Further Details:      
 
Domain Number 4 Region: 97-214
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000173
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000007608   Gene: ENSRNOG00000005726   Transcript: ENSRNOT00000007608
Sequence length 4330
Comment pep:known chromosome:RGSC3.4:4:15911051:16269090:-1 gene:ENSRNOG00000005726 transcript:ENSRNOT00000007608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGXXDAPKSPXPRLXNKPVTGELFGXXAPLFXQASNLISTAGQQGPHPQTGPAAPSKQA
PTPSQSPAAQGPAKSTGQLPPAPAKATAVKKEAKAAAAENLESKPEQAPTAKKTEKDKKP
PPAKVGKPPPSEPEKAVPAHKPDKTTKPKPACPLCRTELNLGSQEPPNFNTCTECKNQVC
NLCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMGKMPPAPSGPKASPMPAPAEPSSQK
TPTGTQVKGKKKEAEGKTEAEKPVPEKETASIEKTPPMVTTDQKLEESEGKKSKVSALPE
KKPSEEEKAISADKKERKPPAEEKPPLEEKKPIPVDKKLPPEAKPLSSEGEEKHEILKAH
VQIPEEEPTGKVAAKTGEEEQQPDSRPEALPGATPLTLPKAGEKERAVAQPQAEGSSKDG
QGERSKEKTEKEEDKSDTSSSQQPKSPQGLSDTGYSSDGISGSLGEIPSLIPSDEKDLLK
GLKKDSFSQESSPSSPSDLAKLESTVLSILEAQASTLVGEKAEKKTQPQKISPEKPQDQQ
KTQTASETLDITISEEEIKESQEKKVSPKKDSEQGFPSRKEHKEKPELVDDLSPRRASYD
SVEDSSESENSPVVRRKRRTSIGSSSSDEYKQEDSQGSGEEEDFIRKQIIEMSADEDASG
SEDEEFIRSQLKEISGVGESQKREEAKGKGKGVAGKHRRLTRKSSTSFDDDAGRRHSWHD
EDDETFDESPELKFRETKSQESEELVVAGGGGLRRFKTIELNSTIADKYSSESSQKKTIL
YFDEEPELEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKGE
SKQQRKARHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQRELEQQQRKSSSKKSKKDK
DELRAQRRRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFE
ISPEKIIEVQKVYKLPAAVSLYSPTDEQSVMQKEGVQKALKSAEEMYEEMMQKPHKYKAF
PAANERDEVFEKEPLYGGMLIEDYIYESLVEDTYNGSVDGSLLTRQEEQNGFMQQRGREQ
KVRLQEQIYDDPMQKISDLQKEFYELESLHSVVPQEDIVSSSYIIPESHEIVDLGSMVMS
TSEEKKLLDADSAYEELMRRQQVQVTDGSSPVQTTIGDDMAESTLDFDRVQDASLTSSIL
SGASLTDSTSSATLSIPDVKITQHFSAEELEDEYVTDYTREIQEIIAHESLILTYSEPSE
SATSVPPSDTPSLTSSISSVCTTDSSSPVTTLDSLTTVYTEPADVMTKFKDSEEISSTYF
PGSIIDYPEDISVSLDRTIMPESRTNEDQIVLSFSGMAPSVVESVGTKPERPQADTISTD
LPISEKDLIKGKKETGDGIILEVLDAYKDKREESEAELTKISLPEPGLAQAPSSQIKEQH
VSPHSVSGKISGQEKPTYRLPSGSLPVSTHPSKSRPFFRSSSLDISAQPPPPPPPPPPPP
PPPPPPPPPPLPPATSPKPPTYPKKKLAVAATVTSTTIVTTHVDALTTVEAAAARRSNGL
PATKMCATAPPPVPPKPSQIPTGLVFTHRPEAIKPPIAPKPAVPQIPVTTQKPTDTCPKP
TGLSLTSTMSLNLVTSADYKLPSPTSPLSPHSNKSSPRYSKSLMDTYVVITLPSEPGTPT
DSSAQAITSWPLGSPPKDLVSLETVFSVVPPMTATEIPSASQPTLYASGALGTFSAGPAV
TPSLFQTVPTPLTQFLPAEVSKPEVSAVRSTVPSVAPRSVSIPIPPEPLALDRHQYKENG
KLPLVGDAIDLRTIPKTEEKATEKCMDLSASAVDVKRQTTVNEVYRRQISAVQPSIINLS
AASSLVTPITMDSKTVAVVTCTDTTVYTTGTESQGGIEHAVTSPLQLTTSKHTELPYRKP
SSQAFPTIRDEAPINLSLGPSAQAVMLAVTKPVTVPPVGVTNGWTDSTLSQGVADGEVVD
LSTSKSHRTVVTMDESTSNVVTKIIEDDEKPVDLTAGRRAVCCDMVYTLPFGRSCTAQQP
ATTLPEDRFGYRDDHYQYDRSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFDYSGG
TGAAVDLTSGRVSTGQYGVATDPALKCHYGVMHLVSEKYPRSGFCLHFCFRWMIWRYILK
YMCIFVSPWFLLLLLPACACMFNIAFLPHLIRLTCGFACSPIHCAHQDKRALRPKQHHSF
HWTITLPCISGEVMDYSSKTTGPYPETRQVISGVGISTPQYSTARMTPPPGPQYGVGSVL
RSSNGVVYSSVATPIPSTFAITTQPGSIFSTTVRDLSGIPTTDAMTSLSALHQSQPMPRS
YFITTGASETDIAVTGIDINASLQTITMETLPAEAMDSVPTLTTASEVFSEVVGEESTLL
IVPDEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLEELQS
MKQHLLYQQEEERQAQFMMRQETLAQQQLQLEQIQQLQQQLHQQLEEQKLRQIYQYNYDP
SGTSSPQTTTEQAILEGQYAATEGSQFWATEDATTTASTVVAIEIPQSQGWYTVQSDGVT
QYIAPPGILSTVSEIPLTDVVVKEEKQPKKRSSGAKVRGQYDEMGESVADDPRNLKKIVD
SGVQTDDEETADRSYASRRRRTKKSVDTSVQTDDEDQDEWDMPSRSRRKARTGKYGDSTA
EGDKTKPLSKVSSVAVQTVAEISVQTEPVGTIRTPSIRARVDAKVEIIKHISAPEKTYKG
GSLGCQTETDSDTQSPPYLGATSPPKDKKRPTPLEIGYSSSHLRADPTVQLAPSPPKSPK
VLYSPISPLSPGNALEPAFVPYEKPLPDDISPQKVLHPDMAKVPPASPKTAKMMQRSMSD
PKPLSPTADESSRAPFQYSEGFTTKGSQTMTASGTQKKVKRTLPNPPPEEVSTGTQSTYS
TMGTASRRRMCRTNTMARAKILQDIDRELDLVERESAKLRKKQAELDEEEKEIDAKLRYL
EMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRPSRVESQHGVERPRTAPQ
TEFSQFIPPQTQTEAQLVPPTSPYTQYQYSSPALPTQAPTPYTQQSHFQQQTLYHQQVSP
YQTQPTFQAVATMSFTPQAQPTPTPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNYEVI
RNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEERSSMASSPISSISADSFYADIDHH
TSRNYVLIDDIGDITKGTAALSTAFSLHEKDLSKTDRLLRTTETRRSQEVTDFLAPLQTS
SRLHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGTESLDHLAGLSHYYHADTSYRHFPKS
EKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKMSKFSPIQESRDLEPDYPTYMS
SGTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGSGLGTLGNTIRSALQDEADK
PYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFGHSSSSARTKPTS
LPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSLPEV
QQHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHGLDR
KLPERLVHSRPLSQHQEQILQMNGKTIHYIFPHARIKITRDSKDHTVSGNGLGIRIVGGK
EIPGHSGEIGAYIAKILPGGSAEHTGKLMEGMQVLEWNGVPLTSKTYEEVQSIINQQSGE
AEICVRLDLNMLSDSENPQHLELHEPPKVVDKAKSPGVDPKQLAAELQKVSLQQSPLVMS
SVVEKGSHAHSGPTSAGSSSVPSPGQPGSPSVSKKKHSSTKPTDATKAASHPITGEIQLQ
INYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGAEYKRRTKYVQKSLNPEWNQ
TVIYKSISMEQLMKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDNTPRWYPLKEQTE
SIDHGKSHSSQNSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHL
RSHGPSRSQSKTSVAQTHLEDAGVAIAAAEAAVQQLRIQPTKPTNHRPAESSVSTGSSGS
SVGSGYSVDSEGSSCVAGEPNLLPIPRIGKMGQNGQDPVKQPGMGATDTEGKTQVMGEIK
LALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLYVKLYVINISTQKKVIKKKTRVC
RHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACIWLDKVDLRKRIVNWH
KLLVSPTQTH
Download sequence
Identical sequences ENSRNOP00000007608 10116.ENSRNOP00000008637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]