SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000008497 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000008497
Domain Number 1 Region: 39-194
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.47e-85
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000426
Further Details:      
 
Domain Number 2 Region: 199-351
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.92e-38
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000008497   Gene: ENSRNOG00000006120   Transcript: ENSRNOT00000008497
Sequence length 437
Comment pep:known chromosome:RGSC3.4:4:2200504:2209657:1 gene:ENSRNOG00000006120 transcript:ENSRNOT00000008497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLARCFLVALASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSGPTPGPSPLFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEAAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAPQSVAEARGAGPAAGIHWYSQLLYHIGTW
LLDSETLHPLGMAVKSS
Download sequence
Identical sequences G3V6T0
ENSRNOP00000008497 10116.ENSRNOP00000008497 ENSRNOP00000008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]