SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012214 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012214
Domain Number 1 Region: 104-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.66e-78
Family GABA-aminotransferase-like 0.0000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012214   Gene: ENSRNOG00000009199   Transcript: ENSRNOT00000012214
Sequence length 523
Comment pep:known chromosome:RGSC3.4:3:78252971:78266869:-1 gene:ENSRNOG00000009199 transcript:ENSRNOT00000012214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTLWFRKTRAGPADHSVLVASFGLIFCLPQKDSTVPTTCTGSASTQDMESGYGDDLQGE
CLRKPDQKQPKLYGVGDPTATFSSDSFCLSSRGRVIKWFWDSAEEGYRTYHMDEYDEDKN
PSGIINLGTSENKLCFDLLSWRLTQNDMLHVEPSLLQYPDWRGHRFLRKEVARFLSFYCK
SPAPLKPENVVVLNGCASLFSALATVLCEPGEVLLIPTPYYGAITQHIYLYGNIRLAYVY
LDSKVTGLNTRPFQLTVEKLEMALQGVNSEGVKVKGLILINPQNPLGDIYSPEELQDFLG
FAMRHKLHVIMDEVYMLSVFEESLGYRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGV
LYTENQHVATAVASLCRYHGLSGLVQHQMAQLLQDHDWISQVYLPENHARLKAAHTYVSE
ELRALGIPFVSRGAGFFIWVDLRKYLREGTFEEEAMLWRRFLDNKVLLSSGKTFECKEPG
WFRVVFSDKENRLRLGMQRMRQVLKGQSQMVEDASRCHTQELQ
Download sequence
Identical sequences Q5XI27
ENSRNOP00000012214 10116.ENSRNOP00000012214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]