SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000012627 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000012627
Domain Number 1 Region: 396-507
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 573-683
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-20
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 690-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000058
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 749-811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000197
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 336-401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 816-876
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 7 Region: 219-337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000772
Family Spermadhesin, CUB domain 0.0084
Further Details:      
 
Domain Number 8 Region: 512-576
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000012627   Gene: ENSRNOG00000009350   Transcript: ENSRNOT00000012627
Sequence length 974
Comment pep:known chromosome:RGSC3.4:10:63995031:64021007:1 gene:ENSRNOG00000009350 transcript:ENSRNOT00000012627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLSSEAPITGEGQATGIREMDGELTAAPTPEQSDRGVHFVTTAPTLKLLNHHPLLEEFLQ
EGLEGREEAPRPALPFQPDSPTPFTPSPLPRLTNQDNRPVFTSPTPAVAAAPTQPHSRKK
PWNPESEPPELYITSPLPPGPSMAVPTLHPEDRPSTTPPSQAWTPTQEGPGDMGRPWVPE
IMSKTTGLGIEGTIATSTASGDDEETTTTTIITTVTTIQPPGPCSWNFSGPEGSLDSPAV
PSVPSDVGLDCLYYISVYPGYGVEIKVKNISLQEGETITVEGLGGPDPLPLANQSFLLRG
QVIRSPTHQAAVRFQSLPLPAGPGTFHFHYQAYLLSCHFPRRPAYGDVTVTSLHPGGSAR
FHCATGYQLKGARFLTCLNATQPFWDSQEPVCIAACGGVIRNATTGRIVSPGFPGNYSNN
LTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGNNVEAPPVYDSYEVEYLPIEGLLS
SGRHFFVEFSTDSSGAAAGMALRYEAFQQGHCYEPFVKYGNFSSSAPSYPVGTTVEFSCD
PGYTLEQGSIIIECVDLRDPQWNETEPACRAVCSGEITDSAGVVLSPNWPEPYGRGQDCI
WGVHVEEDKRIMLDIRVLRIGSGDVLTFYDGDDLTARVLGQYSGPRGHFKLFTSMADVTI
QFQSDPGTSALGYQQGFVIHFFEVPRNDTCPELPEIPNGWKNPSQPELVHGTVVTYQCYP
GYQVVGSSILMCQWDLSWSEDLPSCQRVTSCHDPGDVEHSRRLISSLKFPVGATVQYICD
QGFVLTGSAILTCHDRQAGSPKWSDRAPKCLLEQFKPCHGLSAPENGARSPEKRLHPAGA
TIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASLDGFYNGRSLDVAKAPATSSA
LDAAHMAAAIFLPLVAMVLLVGGVYLYFSRLQGKSPLQLPGTHPRPYNRITVESAFDNPT
YETGSLSFAGDERI
Download sequence
Identical sequences ENSRNOP00000012627 10116.ENSRNOP00000040374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]