SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014239 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014239
Domain Number 1 Region: 21-149
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.04e-36
Family Deoxycytidylate deaminase-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014239   Gene: ENSRNOG00000010705   Transcript: ENSRNOT00000014239
Sequence length 155
Comment pep:known chromosome:RGSC3.4:1:8358164:8372659:1 gene:ENSRNOG00000010705 transcript:ENSRNOT00000014239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKVESTTVPDGSCVVSVQETEKWMEEAMRMAKEALENIEVPVGCLMVYNNEVVGKGRN
EVNQTKNATRHAEMVAIDQVLDWCHRHGQSPSAVFEHTVLYVTVEPCIMCAAALRLMKIP
LVVYGCQNERFGGCGSVLNIASADLPNTGRPFQVI
Download sequence
Identical sequences ENSRNOP00000014239 10116.ENSRNOP00000014239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]