SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014583 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014583
Domain Number 1 Region: 497-682,890-1029
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.19e-59
Family Regulator of chromosome condensation RCC1 0.011
Further Details:      
 
Domain Number 2 Region: 3719-3909
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-28
Family APC10-like 0.017
Further Details:      
 
Domain Number 3 Region: 2226-2269,2352-2395
Classification Level Classification E-value
Superfamily E set domains 0.00000000527
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 4 Region: 4463-4538
Classification Level Classification E-value
Superfamily RING/U-box 0.000000023
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000014583
Domain Number - Region: 3677-3748,4026-4109
Classification Level Classification E-value
Superfamily ARM repeat 0.00136
Family Armadillo repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014583   Gene: ENSRNOG00000010479   Transcript: ENSRNOT00000014583
Sequence length 4715
Comment pep:known chromosome:RGSC3.4:15:87124558:87364839:-1 gene:ENSRNOG00000010479 transcript:ENSRNOT00000014583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPDGSVAASGLGLGLPATDSRGQYQLLLSGRALADRYRRIYTTALSDRDQAGSSTGYP
ASRNKKILNKKKLKRKQKSKSKVKTRSKSENLENTVIIPDIKLHSNPSAFNIYCNVRHCV
LEWQKKEASLAAASRNSVQSGESDSDEEEESRELPIKLPKIIEVGLCEVFELIKETRFSH
PSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITVRSTGVNDSTGQSLTALS
CACLFSLVASWGETGRTLQAISAILTNNGSHACQTIQVPTILNSLQRSVQAVLVGKIQVQ
DWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGH
IYNSTSRIRNRKEKKSWLGYAQGYLLYRDVNNHSMTAIRISPETLEQDGTVMLPDCHTEG
QNILFTDGEYINQIAASRDDGFVVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEK
DLHIISTGFDEESAILGAGREFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK
SPKIVHFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESAKSRRQSKPYKPKKIIKMEGK
IVVCTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVSDLKGHFVTQVAMGKAHTCVLMK
NGEVWTFGVNNKGQCGRDTGAMNQGGKGFGVENMATAMDEDLEEELDEKDEKSMMCPPGM
HKWKLEQCMVCTVCGDCTGYGASCVSSGRPDRVPGGICGCGSGESGCAVCGCCKACAREL
DGQEARQRGILDAVKEMIPLDLLLAVPVPGVNIEEHLQLRQEEKRQRVIRRHRLEDGRGP
LVFAGPIFMNHREQALARLRSHPAQLKHKRDKHKDASGERGEKDASKVTTYPPGSVRFDC
EVRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTA
GSNHTAVLVMDGQVFTFGSFSKGQLGRPILDVPYWNAKPAPMPNIGSKYGRKATWIGASG
DQTFLRIDEALINSHVLATSEIFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDS
EQEDLQGFGVCLDPVYDVLWRFRPSTRELWCYNAVVADARLPSATDMQSSCCILSPELAL
PTGSRALTTRSHAALHILGCLDTLAAMQDLKMGIASIEEETQAVMKVYSKEDYSIVNRFE
SHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFELGPDGGDHETDGDL
LAETDVLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGV
IFQFKSSKKSNNGTDVNAGQIPQLLYRLPTCDGSTSKGKQQTSEPVHILKRSFARTVSVE
CFESLLSILHWSWTTLVLGVEELRGLKGFQFTATLLDLERLRFVGTCCLRLLRVYTCEIY
PVSAVGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMVKLDNDPQGYLSQPLSLLESV
LQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQEANFKTSSSRLLAAVMSALCHTSVK
LTSLFPIAYDGEVLLRSIVKQVSTENESTLVHRFPLLVGHMEKLSQSEENISGMTSFREV
LEKMLVIVVLPVRNSLRRESELFSSHLVSNTCGLLASIVSELTASALGSEVDGLNSLHSV
KASANRFTKTSQGRSWNTGNGSPDAICFAVDKPGIVVVGFSVYGGGGIHEYELEVLVDDS
EHSGDSTHSHRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTA
NGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRSEFDGDLQSQLVSKANE
EDKNCSRALSVVSTVVRAAKDLLHRALAVDADDIPELLSSSSLFSMLLPLIIAYIGPVAA
AIPKVAVEVFGLVQQLLPSVAVLNQKYAPPAFNPNQSTDSTTGNQPEQGLSACTTSNHYA
VIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLTPVRTIQNAGYGA
KVTSAHENLNSWIELKKYSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCF
AIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVC
KTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFIACVPGSSGGRLARWLQP
DSYADPQKTSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQ
QEQVKKSQRVPGSPAAAAAASCTTDMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYE
NYSFEELRFASPTPKRPSENMLIRVNNDGTYCANWTPGAIGLYTVHVTIDGIEIDAGLEV
KVKDPPKGMIPPGTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGT
ITFIDEIHNDDGVWLRLNEETIRKYVPNMNGYTEAWCLSFNQHLGKSLLVPVDNIFNASQ
GVRDLDVLSWTSKAFFPQEPKTTTDDFFKDVNTCCPQEAAVRERDHPFLRGGPGMYKVVK
TGPSGHNIRSCPNLRGIPIGMLVLGNKVKAVGEVTSAEGTWVQLDKNSMVEFCESDEGEA
WSLARDRGGNQYLRHEDEQVLLDQNSQTPPPSPFSVQAFSKGASCSAQGFDYGLGNNKGD
QLSAILNSIQSRPNLPAPSIFDQAAKPPSSLVHSPFVFGQPLSFQQRQLQSDRGTVSTSS
RPVSTSAKSELPSKNSRSVKPDGRVSRTTADQKKPRGTEGLSASESLMLKSDAAKLRSDS
HSRSLSPNHNTLQTLKSDGRVSSSFRAESPGPGSRSSSPKPKTLPTPRSSPSGASSPRSS
SPQDKNLPQKSTAPAKTKLDPPRERSKSDSYTLDPDTLRKKKMPLTEPLRGRSTSPKPKP
VPKDPKGSPGSENRAPSPHVVQENLHSEVVEVCTSSTLKTNGVTDSTCDDSNDFKSVDEG
SNKVHFSIGKAPLKDEQEMRASPKISRKCANRHTRPKKEKSNFLFKGDGAKSLEPAKQAM
SPSVAECARAVFASFLWHEGIVHDAMACSSFLKFNPELSKEHAPIRSSLNSQPPTEEKEI
KLKNRHSLEISSALNMFNISPHGPDISKMGSINKNKVLSMLKEPPLHEKCEDGKSEATFE
MSMHHSVKSRSPLPLTLQHLVAFWEDISLATIKAASQNMIFPSPGSCAVLKKKECEKENK
KTKKEKKKKEKTEIRPRGNLFGEMAQLAVGGPEKDTICELCGESHPYPVTYHMRQAHPGC
GRYAGGQGYNSIGHFCGGWAGNCGDGGMGGSTWYLVCDRCREKYLREKQAAAREKVKQSR
RKPMQVKTPRALPTMEAHQVIKANALFLLSLSSAAEPSILCYHPAKPFQSQLPIVKEGVS
EALPVKMPCLYLQTLARHHHENFVGYQDDNLFQDEMRYLRSTSVPAPYISVTPDASPNVF
EEPESNMKSMPPSLETSPITDTDLAKRTVFQRSYSVVASEYDKQHSILPARVKAIPRRRV
NSGDTEVGSSLLRHPSPELSRLISAHSSLSKGERNFQWPVLAFVIQHHDLEGLEIAMKQA
LRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVAALTPSPVEAEEDEDEDNKSSKENA
EQEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGSSLQQMALRCWSL
KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMNQELCIVMCLKDLT
SIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKTITINCVKGINARYVSVHVDNSR
DLGNKVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDNHIIKIELKGPENTLR
VRQVKVLGWKDGESTKIAGQISASVAQQRSCEAETLRVFRLITSQVFGKLISGDAEPTPE
QEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCAHIVQAIRMEATR
VREEWEHAISSKENANSQPSDEDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDL
CSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASIIGVKSLPPADISDIIHSTEKGDWNKL
GILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWM
KGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKNAIAETIIALTKMEEEFRSPVRCIATT
RLWLALASLCVLDQDHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICGNLCT
DCDRFLHLHRRTKTHQRQVFKEEEEAIKVDLHEGCGRTKLFWLMALADSKTMKAMVEFRE
HTGKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACSKTHPCGHPCGGVRNE
EHCLPCLHGCDKNATTLKQDADDMCMICFTEALSAAPAIQLDCSHVFHLQCCRRVLENRW
LGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTP
GVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAEAGQGDDYDPRELICGACSDVSR
AQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPK
GKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF
Download sequence
Identical sequences ENSRNOP00000014583 10116.ENSRNOP00000014583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]