SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016220 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016220
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-51
Family Calponin-homology domain, CH-domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 5.62e-21
Family EB1 dimerisation domain-like 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016220   Gene: ENSRNOG00000011798   Transcript: ENSRNOT00000016220
Sequence length 268
Comment pep:known chromosome:RGSC3.4:3:144120532:144148837:1 gene:ENSRNOG00000011798 transcript:ENSRNOT00000016220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSGSAAPQRPIATQRTTAAPKAGPGMV
RKNPGMGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
Download sequence
Identical sequences Q66HR2
ENSRNOP00000016220 10116.ENSRNOP00000016220 ENSRNOP00000016220 NP_612518.2.100692 NP_612518.2.4139 XP_006235356.1.100692 XP_006235357.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]