SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017670 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017670
Domain Number 1 Region: 17-156
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 6.66e-36
Family Deoxycytidylate deaminase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017670   Gene: ENSRNOG00000013215   Transcript: ENSRNOT00000017670
Sequence length 178
Comment pep:known chromosome:RGSC3.4:16:47240980:47261897:-1 gene:ENSRNOG00000013215 transcript:ENSRNOT00000017670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGACIVNTENKIVGIGYNGMPNGC
SDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADVKGCSMYVALFPCNECAKLIIQA
GIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTPKYSKIVIDFDSINSRPSQKPQ
Download sequence
Identical sequences Q5M9G0 Q8K2D6
10090.ENSMUSP00000033966 10116.ENSRNOP00000017670 ENSRNOP00000017670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]