SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017696 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017696
Domain Number 1 Region: 52-507
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.55e-102
Family Pyridoxal-dependent decarboxylase 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017696   Gene: ENSRNOG00000013221   Transcript: ENSRNOT00000017696
Sequence length 509
Comment pep:known chromosome:RGSC3.4:8:120428657:120579318:1 gene:ENSRNOG00000013221 transcript:ENSRNOT00000017696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDTDQKEMTPGKKIPVFVDGVVLNGPQTDVKAGEKFVEEACRLIMEEVVLKATDINEKVC
EWQPPEQLRQLLDLEMRDTGESQDKLLKLCQDVIRYSVKTNHPRFFNQLYAGLDYHSLAA
RIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPGGSVSNMCAMNLAR
YRHCPDIKDKGLSGLPRLILFTSAECHYSMKKAASFLGIGTQNVYFVETDGRGKMIPEEL
EKQIWQGKQESFLPFSSPASSTATILLALDPIREVTDMINTYQLWLSAEASWGGSALVSR
KHRRLLHGIHRADSVAWNPHKMLMAGIQCSALLVKDKSDLPKQCYQSKARYLFTLDRTYD
LSHDSVESLIQCTRRPETMKIYLLWKISSTSNKEERENRIFGLSKYLVDEIKKREGFKLL
IEPEYTNVCFWYIPPSLREMAEGPEFWRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNF
FRQVVISPQVSREDMDFLLDEIDSLGRDM
Download sequence
Identical sequences 10116.ENSRNOP00000017696 ENSRNOP00000017696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]