SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020615 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020615
Domain Number 1 Region: 396-496
Classification Level Classification E-value
Superfamily E set domains 2.6e-24
Family Filamin repeat (rod domain) 0.0026
Further Details:      
 
Domain Number 2 Region: 186-243
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000488
Family B-box zinc-binding domain 0.0031
Further Details:      
 
Domain Number 3 Region: 27-56
Classification Level Classification E-value
Superfamily RING/U-box 0.00000677
Family RING finger domain, C3HC4 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000020615
Domain Number - Region: 223-328
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00128
Family Apolipoprotein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020615   Gene: ENSRNOG00000015347   Transcript: ENSRNOT00000020615
Sequence length 607
Comment pep:known chromosome:RGSC3.4:2:195971777:195980471:1 gene:ENSRNOG00000015347 transcript:ENSRNOT00000020615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSENRKPLPGFVNKLQDASASGSSGKTHCPSCLRLFKVPRLLPCLHTVCTSCLERLDPFS
VVDIRGGDSDTSSEGSIFQEPKSCSLKPQIGILCPVCDAQVDLPLGGVKALTVDHLAMND
VMLESLHGEGQGLVCDLCSDREVEKRCQTCKANLCHFCCQAHRRQKKTTDHTMVDLKDLK
GYSRVGKPILCPSHPAEELRLFCELCDRPVCRDCVVGEHREHPYDFTSNVIHKHGDSVRE
LLRDTQPHVEALEDALAQIKSSNNALQERVEAVAADVRTFSEGYIRAIEEHRDKLLRQLD
DIRVQKENSLQLQKAQLEQLLADMRTGVEFTEHLLTSGSDLEILVTKGVVVERLRKLNKV
EYSARPGVNHKICFSPQEKARCQGYEVYGAINTQEVDPAQCVLQGEDLHRAREKQTASFT
LVCKDATGESMSRGGDNVRVEVVPKNKKDSPIRTVVQDNKDGSYRVSYTPKEPGVYTVWV
GIREQQVQGSPFNVTVRRKHRPHPGVFHCCTFCSSGGQKTARCACGGTMPARWPKQQQAR
GLPFTASQVGTLAVAMDTKATRGVHTGLAVGSLLRSQSVRTQLGRAHRGVCLGPWHSDGF
LGTSWAR
Download sequence
Identical sequences ENSRNOP00000020615 10116.ENSRNOP00000020615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]