SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022851 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022851
Domain Number 1 Region: 84-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-69
Family AAT-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022851   Gene: ENSRNOG00000016841   Transcript: ENSRNOT00000022851
Sequence length 522
Comment pep:known chromosome:RGSC3.4:19:22884586:22915553:-1 gene:ENSRNOG00000016841 transcript:ENSRNOT00000022851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPERSPRDRILTLESMNPQVKAV
EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPN
LLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNI
YLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEDNCW
ALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEV
YQDNVYSPDCRFHSFKKVLYQMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHP
EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPGEESFEQFTREKESVLGNLAKKAKLTE
DLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPG
SGFGQREGTYHFRMTILPPVEKLKTVLHKVKDFHLKFLEKYS
Download sequence
Identical sequences ENSRNOP00000022851 NP_001012057.1.100692 NP_001012057.1.4139 XP_008770627.1.100692 XP_008770628.1.100692 ENSRNOP00000022851 10116.ENSRNOP00000022851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]