SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024677 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024677
Domain Number 1 Region: 258-447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-40
Family Laminin G-like module 0.0000000125
Further Details:      
 
Domain Number 2 Region: 463-669
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-36
Family Laminin G-like module 0.0000000391
Further Details:      
 
Domain Number 3 Region: 46-103
Classification Level Classification E-value
Superfamily GLA-domain 5.89e-19
Family GLA-domain 0.00063
Further Details:      
 
Domain Number 4 Region: 109-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 234-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000769
Family EGF-type module 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024677   Gene: ENSRNOG00000018233   Transcript: ENSRNOT00000024677
Sequence length 674
Comment pep:known chromosome:RGSC3.4:16:80900159:80930927:1 gene:ENSRNOG00000018233 transcript:ENSRNOT00000024677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPGPTAALGTALLLLLLASESSHTVLLRAREAAQFLRPRQRRAYQVFEEAKQGHLER
ECVEEVCSKEEAREVFENDPETDYFYPRYQECMRKYGRPEDKNPNFATCVKNLPDQCTPN
PCDKKGTQLCQDLMGNFFCLCKDGWGGRLCDKDVNECSQKNGGCSQVCHNKPGSFQCACH
SGFSLQSDNKSCQDIDECTDSDTCGDARCKNLPGSYSCLCDKGYTYSSKEKTCQDVDECQ
QDRCEQTCVNSPGSYTCHCNGRGGLKLSPDMDTCEDILPCVPFSMAKSVKSLYLGRMFSG
TPVIRLRFKRLQPTRLLAEFDFRTFDPEGVLFFAGGRSDSTWIVLGLRAGRLELQLRYNG
VGRITSSGPTINHGMWQTISVEELDRNLVIKVNKDAVMKIAVAGGLFQLERGLYHLNLTV
GGIPFKESDLVQPINPRLDGCMRSWNWLNGEDSAIQETVKANTKMQCFSVTERGSFFPGN
GFAFYSLNYTRTSLDVGTETTWEVEVVARIRPATDTGVLMALVGDKDVVLLSVALVDYHS
TKKLKKQLVVLAVENVALALMEIKVCDSQEHTVTVSLRDGEATLEVDGTKGQSEVSTAQL
QERLDLLKTRLQGSVLTFVGGLPDVQVTSTPVTAFYRGCMTLEVNGKTLDLDTASYKHSD
ITSHSCPPVEHVTA
Download sequence
Identical sequences Q63772
ENSRNOP00000024677 ENSRNOP00000024677 10116.ENSRNOP00000024677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]