SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024733 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024733
Domain Number 1 Region: 11-182
Classification Level Classification E-value
Superfamily E set domains 2.38e-69
Family Arrestin/Vps26-like 0.0000000647
Further Details:      
 
Domain Number 2 Region: 185-390
Classification Level Classification E-value
Superfamily E set domains 2.43e-63
Family Arrestin/Vps26-like 0.000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024733   Gene: ENSRNOG00000018185   Transcript: ENSRNOT00000024733
Sequence length 403
Comment pep:known chromosome:RGSC3.4:9:86759933:86799768:1 gene:ENSRNOG00000018185 transcript:ENSRNOT00000024733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACVKTNKSHVIFKKVSRDKSVTIYLGKRDYIDHVSQVEPVDGVVLVDPELVKGKKVYV
TLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAMSAPTQLQLSLLKKLGDNTYPFL
LTFPDYLPCSVMLQPAPQDVGKSCGVDFEVKAFATDITDAEEDKIPKKSSVRLLIRKVQH
APPEMGPQPCAEASWQFFMSDKPLHLSVSLSKEIYFHGEPIPVTVTVTNNTEKVVKKIKV
SVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLVLVPLLANNRERRGIALDGKI
KHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVATEVPFRLMHPQ
PEDPAKESVQDENLVFEEFARQNLKDTGENTEGKKDEDAGQDE
Download sequence
Identical sequences P15887
NP_037155.2.100692 NP_037155.2.4139 XP_008765418.1.100692 ENSRNOP00000024733 10116.ENSRNOP00000024733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]