SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026812 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026812
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.51e-88
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 280-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-32
Family Spectrin repeat 0.000000775
Further Details:      
 
Domain Number 3 Region: 516-637
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-31
Family Spectrin repeat 0.00000456
Further Details:      
 
Domain Number 4 Region: 397-512
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-24
Family Spectrin repeat 0.00000191
Further Details:      
 
Domain Number 5 Region: 745-872
Classification Level Classification E-value
Superfamily EF-hand 3.73e-22
Family EF-hand modules in multidomain proteins 0.021
Further Details:      
 
Domain Number 6 Region: 641-752
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-20
Family Spectrin repeat 0.00000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026812   Gene: ENSRNOG00000019745   Transcript: ENSRNOT00000026812
Sequence length 900
Comment pep:known chromosome:RGSC3.4:1:207475570:207492267:-1 gene:ENSRNOG00000019745 transcript:ENSRNOT00000026812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMVMQPEGLGAGEGPFSGGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRK
AGTQIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKL
VSIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQ
NFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDI
VNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELL
EWIRRTVPWLENRVGEPSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRL
SHRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHE
AWTRGKEEMLNQHDYESASLQEVRALLRRHEAFESDLAAHQDRVEHIAALAQELNELDYH
EAASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDG
AIEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPK
SGNPYITLSSQDINNKWDTVRKLVPSRDQTLQEELARQQVNERLRRQFAAQANAIGPWIQ
GKVEEVGRLAAGLAGSLEEQMAGLRQQEQNIINYKSNIDRLEGDHQLLQEGLVFDNKHTV
YSMEHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMME
PDDFRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVAS
FKILAGDKNYITPEELRRELPAEQAEYCIRRMAPYKGSGAPSGALDYVAFSSALYGESDL
Download sequence
Identical sequences Q8R4I6
NP_596915.1.100692 NP_596915.1.4139 ENSRNOP00000026812 ENSRNOP00000026812 10116.ENSRNOP00000026812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]