SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027773 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027773
Domain Number 1 Region: 39-268
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.13e-85
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 286-408
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-35
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 522-640
Classification Level Classification E-value
Superfamily Spectrin repeat 9.42e-30
Family Spectrin repeat 0.00000571
Further Details:      
 
Domain Number 4 Region: 409-517
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-25
Family Spectrin repeat 0.00000355
Further Details:      
 
Domain Number 5 Region: 646-758
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-23
Family Spectrin repeat 0.00000299
Further Details:      
 
Domain Number 6 Region: 751-903
Classification Level Classification E-value
Superfamily EF-hand 9.93e-23
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027773   Gene: ENSRNOG00000020433   Transcript: ENSRNOT00000027773
Sequence length 911
Comment pep:known chromosome:RGSC3.4:1:84000724:84073767:-1 gene:ENSRNOG00000020433 transcript:ENSRNOT00000027773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYER
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTSVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANM
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKS
FSTALYGESDL
Download sequence
Identical sequences Q1A602 Q9QXQ0
NP_113863.2.100692 NP_113863.2.4139 ENSRNOP00000027773 10116.ENSRNOP00000027773 ENSRNOP00000027773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]