SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027872 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027872
Domain Number 1 Region: 117-352
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.78e-42
Family Voltage-gated potassium channels 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027872   Gene: ENSRNOG00000020532   Transcript: ENSRNOT00000027871
Sequence length 469
Comment pep:known chromosome:RGSC3.4:1:203383419:203472247:1 gene:ENSRNOG00000020532 transcript:ENSRNOT00000027871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTASSPPNAERKRAGWGRLLGARRGSAGLAKKCPFSLELAEGGPTGGTVYAPIAPTGAP
GLAPPMSPPVSPVPAPADLGPRPRVSLDPRVSIYSTRRPLLARTHIQGRVYNFLERPTGW
KCFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGC
RSKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLH
VDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYA
DALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQR
QKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYVRKPARSHTLLSPSPKPKKSVMVKK
KKFKLDKDNGLSPGEKIFNVPHITCDPPEDRRPDHFSIDGYDSSGKQTP
Download sequence
Identical sequences 10116.ENSRNOP00000027875 ENSRNOP00000027872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]