SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030340 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030340
Domain Number 1 Region: 30-409
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.57e-105
Family Cystathionine synthase-like 0.0000000000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030340   Gene: ENSRNOG00000023856   Transcript: ENSRNOT00000029127
Sequence length 414
Comment pep:known chromosome:RGSC3.4:9:92412128:92422075:1 gene:ENSRNOG00000023856 transcript:ENSRNOT00000029127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRMLAKASVTLGSRAASWVRNMGSHQLLVPPPEALSKPLSIPKRLLLGPGPSNLAPRVL
AAGSLRMIGHMQKEMFQIMDEIKQGIQYVFQTRNPLTLVVSGSGHCAMETALFNLLEPGD
SFLVGTNGIWGIRAAEIAERIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLTHGES
STGVLQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDILYSGSQKVLNAPPGIS
LISFNDKAKSKVYSRKTKPVSFYTDITYLSKLWGCEGKTRVIHHTLPVISLYCLRESLAL
ISEQGLENSWRRHREATAHLHKCLRELGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSY
VLDHFNIEISGGLGPSEDKVLRIGLLGYNATTENADRVAEALREALQHCPKNKL
Download sequence
Identical sequences P09139
ENSRNOP00000030340 10116.ENSRNOP00000030340 ENSRNOP00000030340 NP_085914.2.100692 NP_085914.2.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]