SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033513 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033513
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000746
Family HLH, helix-loop-helix DNA-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033513   Gene: ENSRNOG00000022069   Transcript: ENSRNOT00000030765
Sequence length 104
Comment pep:known chromosome:RGSC3.4:16:36324324:36326037:-1 gene:ENSRNOG00000022069 transcript:ENSRNOT00000030765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SITSALAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKK
TDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences ENSRNOP00000033513 10116.ENSRNOP00000033513 ENSRNOP00000033513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]