SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000033649 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000033649
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily UBC-like 3.23e-21
Family RWD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000033649   Gene: ENSRNOG00000022500   Transcript: ENSRNOT00000035323
Sequence length 188
Comment pep:known chromosome:RGSC3.4:16:47930303:47946521:-1 gene:ENSRNOG00000022500 transcript:ENSRNOT00000035323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGEDGDPKAFLIEISWTETYPQTPP
VISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTLFEYAKDNKEQFMENHHPGSS
TTPIANIISVETPSAAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLS
KSGSKDDE
Download sequence
Identical sequences Q569B7
NP_001030166.1.100692 NP_001030166.1.4139 10116.ENSRNOP00000033649 ENSRNOP00000033649 ENSRNOP00000033649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]