SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039255 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039255
Domain Number 1 Region: 482-551
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000418
Family VWC domain 0.0044
Further Details:      
 
Domain Number 2 Region: 134-195
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000471
Family VWC domain 0.004
Further Details:      
 
Domain Number 3 Region: 309-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000387
Family VWC domain 0.008
Further Details:      
 
Domain Number 4 Region: 600-666
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000638
Family VWC domain 0.0087
Further Details:      
 
Domain Number 5 Region: 1152-1213
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000387
Family VWC domain 0.0091
Further Details:      
 
Domain Number 6 Region: 897-962
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000659
Family VWC domain 0.018
Further Details:      
 
Domain Number 7 Region: 779-844
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000126
Family VWC domain 0.02
Further Details:      
 
Domain Number 8 Region: 197-255
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 9 Region: 955-1020
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000847
Family VWC domain 0.0073
Further Details:      
 
Domain Number 10 Region: 428-489
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000126
Family VWC domain 0.0042
Further Details:      
 
Domain Number 11 Region: 367-429
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000022
Family Fibronectin type I module 0.062
Further Details:      
 
Domain Number 12 Region: 257-316
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000345
Family VWC domain 0.026
Further Details:      
 
Domain Number 13 Region: 1014-1089
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000009
Family VWC domain 0.016
Further Details:      
 
Domain Number 14 Region: 721-784
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000115
Family VWC domain 0.033
Further Details:      
 
Domain Number 15 Region: 1482-1547
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000948
Family ATI-like 0.036
Further Details:      
 
Domain Number 16 Region: 541-602
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000146
Family VWC domain 0.028
Further Details:      
 
Domain Number 17 Region: 838-893
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000418
Family VWC domain 0.078
Further Details:      
 
Domain Number 18 Region: 1102-1149
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000262
Family VWC domain 0.01
Further Details:      
 
Domain Number 19 Region: 678-718
Classification Level Classification E-value
Superfamily FnI-like domain 0.000023
Family VWC domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000039255
Domain Number - Region: 93-131
Classification Level Classification E-value
Superfamily FnI-like domain 0.00439
Family VWC domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039255   Gene: ENSRNOG00000021855   Transcript: ENSRNOT00000050644
Sequence length 1554
Comment pep:known chromosome:RGSC3.4:4:56363138:56389182:-1 gene:ENSRNOG00000021855 transcript:ENSRNOT00000050644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARAALLLLLLLLHLWNLALAARGGEVSKGQPRLADVLESQQQAPSHSLVPCETQQQQ
LCPLEERLERLEADVTYLRKQNRDLQARLLQLESCKCCWGPGHPCPEGARWEPDACTACV
CRDGTTHCGPQPNLPHCRGCSHNGQSYGHGETFSPDACTTCRCLAGAVQCQGPSCSELNC
LESFTPPGECCPICRPGCEYEGQLHQEGTSFLSTSNPCLQCSCLRSLVRCVPVKCQPSPC
PNPVLRPGHCCPVCQASGCTEGHSHRDHGQEWTTPGDPCRICQCLEGHIQCRQQECASLC
PYPARPLPGTCCPVCDGCFLNGREHSSGEPVGSQDPCSSCHCANGSVQCEPLPCPPAPCR
YPGRIPGQCCPVCDGCKYQGHEYRSQETFTLQENGRCLRCTCQAGEVSCEEQDCPVTPCV
HTASGPQLCSACVLNGEEFAEGIQWEPDDQPCTTCSCQDGVPVCRAALCSPVPCQHPTQP
PGACCPSCESCTYHGLVYSNGQNFTDVDSPCQTCYCEDGTVRCSVINCPSLTCAKPQNGP
GQCCPKCPDCILEAQMFVDGERFPHPRDPCQECLCQEGQTHCQLRACHSAPCGHPLPSTC
CRNDCKGCAFGGKEYLNGADFPHPTDPCRMCRCLSGNVQCLARRCPPLACPQPVLTPGDC
CPQCPDAPAGCPQSGNTVLVRHQEHFFQPGDPCSRCLCLDGSVSCQRLPCPPAPCAHPRQ
GACCPSCDGCLYHGKEFANGERFPSPSVTCHVCLCWEGSVNCEPRACAPAQCPFPTREDC
CPACDSCEYLGVSYLNSQEFPDPREACNLCTCLGGFVTCTRRPCEPPACSHPLILPKHCC
PTCQGCLYHGITAALGETLPDPLDPTCSLCTCEEGSMRCHKKPCPPALCTHPSPGPCFCP
VCRSCLFQGQEHQDGEEFEGPEGSCERCRCLAGQVSCMRLQCPPLPCLLQATEPGTCCPR
CTGCRVRGEEHPEGSSWVPADSPCSSCMCHKGIVTCAQVQCVSACIWPQQGPSDCCPSCS
GCEHEGRKYEPGESFQPGDDPCEVCICELKGKGPPSLHCRRRQCPSLVGCPPSQLLPPGP
QHCCPACAQALSNCTEDLLGSELVPPDPCYTCQCQDLTWLCTHRACPALSCPLWEHHTTP
GSCCPVCKDPTGSCSHQGRWVASGEHWIVDACTSCACVAGTVHCQSQRCRNLSCGRDEVP
ALSPGSCCPRCLPGLASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSEDFSVHVTND
DRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHA
QPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEAAFGNSWK
VPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKSSPFSRCHAVVPPEPFFAACV
YDLCACGPGSSADTCLCDALEAYASHCRQAGVTPVWRGPTLCVVGCPVERGFVFDECGPP
CPRTCFNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEGHCISPEACPSVLLTGG
Download sequence
Identical sequences ENSRNOP00000039255 ENSRNOP00000043530 10116.ENSRNOP00000043530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]