SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041230 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041230
Domain Number 1 Region: 92-329
Classification Level Classification E-value
Superfamily L domain-like 1.76e-39
Family Leucine rich effector protein YopM 0.051
Further Details:      
 
Domain Number 2 Region: 652-762
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041230   Gene: ENSRNOG00000029582   Transcript: ENSRNOT00000044010
Sequence length 772
Comment pep:known chromosome:RGSC3.4:X:30376409:30458348:1 gene:ENSRNOG00000029582 transcript:ENSRNOT00000044010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASQGGGGNSGGGGCGGGGSGGGSGAAGGGGGGGGGGGGGAGAGGGGGCGGTVAVPIPV
PTLFGQPFPNGPQWHSGSLQPQHTVRSLDRALEEAGNSGILSLSGRKLREFPGSGYDLTD
TTQADLSRNRFTEIPSDVWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNISRNLLSTL
PKYLFDLPLKVLVVSNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKLHSLKELNI
RRNNLHVLPDELGDLPLVKLDFSCNKVTEIPVCYRKLHQLQVIILDNNPLQVPPAQICLK
GKVHIFKYLNIQACCRMDKKPDSLDLPSLNKRMPSQPLTDSMEDFYPNKNHGPDSGIGSD
NGEKRLSTTEPSDDDTISLHSQVSESNREQTSRTDSLVTGTKPDSQKDQEVYDFIDPNTE
EVAVPEQGDTHIGSFVSFLKGKEKCPEKSQKNEELGNEKKVDKEQLLPEEDDDLKEVTDL
RKIAAQLLKQEQKNRILNHSTSVMRNKLKQTVECEKSVSADEGNSPLSPLAWQPLENQKD
QIVDQQWPESQPIIWQNEERRRSKQIRKEYFKYKSTRKNSSGNENEEQESDNAHMSPQSP
VSSEDYDRSDGFSHGPFGLKPRSAFSRASRQEYGAADPGFTMRRKMEHLREEREQIRQLR
NNLESRLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLSMAKCRRNVE
NFLDACKKLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSMA
Download sequence
Identical sequences D4A456
ENSRNOP00000038957 ENSRNOP00000041230 10116.ENSRNOP00000038957 XP_001057911.2.100692 XP_003754883.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]