SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041826 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041826
Domain Number 1 Region: 4-394
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.53e-105
Family AAT-like 0.0000000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041826   Gene: ENSRNOG00000004880   Transcript: ENSRNOT00000006466
Sequence length 405
Comment pep:known chromosome:RGSC3.4:3:5026632:5028491:-1 gene:ENSRNOG00000004880 transcript:ENSRNOT00000006466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARVSSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYQDDNGKPYVLPNVRKAEVQ
IAGKNLDKEYLPIWGLAEFCKASAELALDKKNEVLKSGQFVTVQTISGTGALRVGASFLQ
RFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQNV
LILHTCAHNPMGVDLRPKQKKEMASVVKKRLSAFFDMAYQGFASGDGDKDSWTMQHFTEQ
SINVCLCQSYAKNMGLYGEHVGAFTMVCKDAKEAKRVESQLKILTRSLYSNPRLNGAWIA
ATILTSPDLRKQWLQEVKGMADHISMRTQLVSNLKKEGLSHNWQHITDWIGMFCFAGLKP
EQVERLTKEFSVYMTKDGQISMAGVTSDNVGYLALPFTRSYLRIK
Download sequence
Identical sequences 10116.ENSRNOP00000041826 ENSRNOP00000041826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]