SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041892 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041892
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 1.08e-82
Family Arrestin/Vps26-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 177-393
Classification Level Classification E-value
Superfamily E set domains 7.93e-74
Family Arrestin/Vps26-like 0.00000000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041892   Gene: ENSRNOG00000030404   Transcript: ENSRNOT00000040886
Sequence length 418
Comment pep:known chromosome:RGSC3.4:1:156871562:156937540:1 gene:ENSRNOG00000030404 transcript:ENSRNOT00000040886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLNNR
Download sequence
Identical sequences P29066
ENSRNOP00000041892 10116.ENSRNOP00000046069 NP_037042.1.100692 NP_037042.1.4139 XP_003514614.1.69978 ENSRNOP00000046069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]