SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046802 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046802
Domain Number 1 Region: 31-145
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.14e-19
Family AAT-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046802   Gene: ENSRNOG00000043092   Transcript: ENSRNOT00000044402
Sequence length 157
Comment pep:known chromosome:RGSC3.4:15:85970341:85970860:-1 gene:ENSRNOG00000043092 transcript:ENSRNOT00000044402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLQSGHILSGMAAASHPCLAAAASARASSWWSHVEMRLPDPILEVTKTFERDTHSKMN
LGVGANRDGNGQPYMLPSVWKAEAQIAAKSLDNEYQPIGGLAEFCKAFQNNNEVLKSGWF
VTVQTISATGALRIGVSFLQRFFKFRGNHMAIFRDAG
Download sequence
Identical sequences ENSRNOP00000046802 10116.ENSRNOP00000046802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]